PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400011974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 264aa    MW: 29614.8 Da    PI: 7.3879
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400011974genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.53.7e-28959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k ien  nrqvtfskRr+g+lKKA ELSvLCd evaviifsstgkl+e+ss
  PGSC0003DMP400011974  9 KLIENVNNRQVTFSKRRAGLLKKAGELSVLCDSEVAVIIFSSTGKLFEFSS 59
                          569**********************************************96 PP

2K-box55.72.2e-1985159983
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                            e++  ++ q+e++ Lk+e+ +L+ +q +llG+dL+ + l+eL+ Le+qL+++l  i+++K+ell++q+e+++k+
  PGSC0003DMP400011974  85 SETHVLKQEQKEVDSLKDELAKLKMKQLRLLGKDLNGMGLNELRLLEHQLNEGLLAIKERKEELLIQQLEYSRKQ 159
                           455557889***************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.413161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-31274IPR002100Transcription factor, MADS-box
CDDcd002651.31E-39275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003197.8E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-1385161IPR002487Transcription factor, K-box
PROSITE profilePS5129710.76790185IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010047Biological Processfruit dehiscence
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0060862Biological Processnegative regulation of floral organ abscission
GO:0060867Biological Processfruit abscission
GO:0071365Biological Processcellular response to auxin stimulus
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRGKIDIKL IENVNNRQVT FSKRRAGLLK KAGELSVLCD SEVAVIIFSS TGKLFEFSST  60
SMKQTLSRYN RCVASTDNSA VEKKSETHVL KQEQKEVDSL KDELAKLKMK QLRLLGKDLN  120
GMGLNELRLL EHQLNEGLLA IKERKEELLI QQLEYSRKQG GSFLTQLLLP SHELQVEELR  180
GLFPLSASLP PPFLEYDRPL EKKYSILKES KESLDSDTAC EDGVDDEDSN TTLQLGLPTI  240
CRKRKRTEQE SPSSNSENQG GSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-20169169Myocyte-specific enhancer factor 2B
1tqe_R1e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-20169169Myocyte-specific enhancer factor 2B
1tqe_P1e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00508DAPTransfer from AT5G13790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0142201e-137BT014220.1 Lycopersicon esculentum clone 133400R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324817.11e-179PREDICTED: agamous-like MADS-box protein AGL15 isoform X1
SwissprotQ388472e-62AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBLM1A8X20.0M1A8X2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000174160.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.14e-58AGAMOUS-like 15
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]